TG003182

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S]YSCSYR.T (PE000538)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S (N28)
Mod(s) 57.021 (C31)
Molecular Weight 5,923.458
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_48_UO1_Erlic_E5
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
41.064 40.848 67.735 1,182.100 5+ 1,181.520 4+ Y[pH2N2] 100.0
41.064 40.848 67.735 1,182.100 5+ 1,575.024 3+ Y[pH2N2] 31.5
41.064 40.848 67.735 1,182.100 5+ 1,629.041 3+ Y[pH3N2] 28.3
41.064 40.848 67.735 1,182.100 5+ 1,399.295 3+ Y[pN] 22.8
41.064 40.848 67.735 1,182.100 5+ 1,313.316 4+ Y[pH4N3] 11.5
41.064 40.848 67.735 1,182.100 5+ 1,521.006 3+ Y[pHN2] 10.8
41.064 40.848 67.735 1,182.100 5+ 1,049.724 4+ Y[pN] 8.0
41.064 40.848 67.735 1,182.100 5+ 1,696.734 3+ Y[pH3N3] 5.5
41.064 40.848 67.735 1,182.100 5+ 1,750.752 3+ Y[pH4N3] 5.4

Spectra

9285;EThcD;41.059;9282;1182.304;Byonic:q-value=5.9e-13/GPS:MinICScore=276.404
9287;HCD;41.064;9282;1182.304;