TG003161

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S]YSCSYR.T (PE000249)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S (N27)
Mod(s) 57.021 (C30)
Molecular Weight 5,767.357
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_48_UO1_Erlic_E5
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.259 44.410 76.954 1,438.348 4+ 1,698.718 3+ Y[pH4N3] 32.7
44.259 44.410 76.954 1,438.348 4+ 1,644.701 3+ Y[pH3N3] 19.4
44.259 44.410 76.954 1,438.348 4+ 1,347.262 3+ Y[pN] 17.7
44.259 44.410 76.954 1,438.348 4+ 1,347.065 4+ Y[pH4N3S] 15.0
44.259 44.410 76.954 1,438.348 4+ 1,522.990 3+ Y[pH2N2] 5.8

Spectra

10200;EThcD;44.262;10188;1438.352;Byonic:q-value=1.72e-14/GPS:MinICScore=11.382
10202;HCD;44.270;10188;1438.352;