TG003140

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4]YSCSYR.T (PE000284)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 5,476.262
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_48_UO1_Erlic_E5
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
41.395 41.382 69.117 1,365.574 4+ 1,698.718 3+ Y[pH4N3] 35.4
41.395 41.382 69.117 1,365.574 4+ 1,644.701 3+ Y[pH3N3] 22.6
41.395 41.382 69.117 1,365.574 4+ 1,347.262 3+ Y[pN] 13.6
41.395 41.382 69.117 1,365.574 4+ 1,522.990 3+ Y[pH2N2] 6.4

Spectra

9388;EThcD;41.389;9379;1365.573;Byonic:q-value=7.95e-09/GPS:MinICScore=94.479
9390;HCD;41.395;9379;1365.573;