TG003055

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000224)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,058.453
Charge 6+
Protein A1BG (P04217)
Spectrum File MS_48_UO1_Erlic_E5
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
47.988 47.794 85.712 1,007.750 6+ 1,347.262 3+ Y[pN] 43.1
47.988 47.794 85.712 1,007.750 6+ 1,347.065 4+ Y[pH4N3S] 38.7
47.988 47.794 85.712 1,007.750 6+ 1,522.990 3+ Y[pH2N2] 18.4
47.988 47.794 85.712 1,007.750 6+ 1,577.008 3+ Y[pH3N2] 16.0
47.988 47.794 85.712 1,007.750 6+ 1,468.972 3+ Y[pHN2] 9.7
47.988 47.794 85.712 1,007.750 6+ 1,414.955 3+ Y[pN2] 9.2
47.988 47.794 85.712 1,007.750 6+ 1,010.698 4+ Y[pN] 5.3

Spectra

11298;EThcD;47.926;11296;1008.087;Byonic:q-value=6.61e-05/GPS:MinICScore=84.844
11300;HCD;47.932;11296;1008.087;
11313;EThcD;47.972;11312;1007.754;Byonic:q-value=1.52e-06/GPS:MinICScore=529.822
11315;HCD;47.980;11312;1007.754;