TG002957

From GPTWiki
Jump to navigation Jump to search
Peptide R.SNHVSRTEVSSNHVLIYLDKVSN[H5N4FS]QTLSLFFTVLQDVPVR.D (PE001283)
Sequence SNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4FS (N23)
Mod(s)
Molecular Weight 6,519.085
Charge 6+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
82.112 81.784 171.856 1,084.520 6+ 1,549.147 3+ Y[pN] 13.6
82.112 81.784 171.856 1,084.520 6+ 1,549.249 4+ Y[pH4N4S] 11.1
82.112 81.784 171.856 1,084.520 6+ 1,293.909 4+ Y[pH2N2] 7.3
82.112 81.784 171.856 1,084.520 6+ 1,330.423 4+ Y[pH2N2F]* 6.7
82.112 81.784 171.856 1,084.520 6+ 1,370.936 4+ Y[pH3N2F]* 5.8
82.112 81.784 171.856 1,084.520 6+ 1,253.396 4+ Y[pHN2] 5.4
82.112 81.784 171.856 1,084.520 6+ 1,597.833 3+ Y[pNF]* 5.3

Spectra

20476;EThcD;82.085;20467;1084.860;Byonic:q-value=6.77e-10/GPS:MinICScore=28.413
20478;HCD;82.090;20467;1084.860;
20490;EThcD;82.128;20479;1084.693;Byonic:q-value=6.03e-10/GPS:MinICScore=216.682
20492;HCD;82.134;20479;1084.693;