TG002955

From GPTWiki
Jump to navigation Jump to search
Peptide R.SNHVSRTEVSSNHVLIYLDKVSN[H5N4S2]QTLSLFFTVLQDVPVR.D (PE001282)
Sequence SNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4S2 (N23)
Mod(s)
Molecular Weight 6,664.122
Charge 5+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
85.931 85.910 182.531 1,330.230 5+ 1,724.876 3+ Y[pH2N2] 16.9
85.931 85.910 182.531 1,330.230 5+ 1,549.147 3+ Y[pN] 16.6
85.931 85.910 182.531 1,330.230 5+ 1,778.893 3+ Y[pH3N2] 16.6
85.931 85.910 182.531 1,330.230 5+ 1,549.249 4+ Y[pH4N4S] 11.5
85.931 85.910 182.531 1,330.230 5+ 1,425.705 4+ Y[pH4N3] 11.0
85.931 85.910 182.531 1,330.230 5+ 1,385.192 4+ Y[pH3N3] 9.9
85.931 85.910 182.531 1,330.230 5+ 1,670.858 3+ Y[pHN2] 5.6
85.931 85.910 182.531 1,330.230 5+ 1,293.909 4+ Y[pH2N2] 5.3

Spectra

21754;EThcD;85.926;21743;1330.639;Byonic:q-value=0.00133/GPS:MinICScore=60.628
21756;HCD;85.931;21743;1330.639;