TG002952

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4S2]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE000268)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4S2 (N17)
Mod(s)
Molecular Weight 6,848.33
Charge 5+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
89.511 1,367.072 5+ 1,308.853 5+ Y[pH5N4S] 100.0
89.511 1,367.072 5+ 1,250.634 5+ Y[pH5N4] 30.2
89.511 1,367.072 5+ 1,431.244 4+ Y[pH3N3] 11.9
89.511 1,367.072 5+ 1,208.164 4+ Y[pN] 9.7
89.511 1,367.072 5+ 1,610.550 3+ Y[pN] 8.6
89.511 1,367.072 5+ 1,339.961 4+ Y[pH2N2] 7.1
89.511 1,367.072 5+ 1,544.531 4+ Y[pH4N3S] 5.4
89.511 1,367.072 5+ 1,380.474 4+ Y[pH3N2] 5.1

Spectra

22849;EThcD;89.506;22838;1367.278;Byonic:q-value=2.2e-06/GPS:MinICScore=20.879
22851;HCD;89.511;22838;1367.278;