TG002944

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4F2]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE001285)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4F2 (N17)
Mod(s)
Molecular Weight 6,558.255
Charge 6+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum