TG002937

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4S]QTLSLFFTVLQDVPVRDLKPAIVK.V (PE000245)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4S (N17)
Mod(s)
Molecular Weight 6,557.235
Charge 6+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
85.402 1,090.879 6+ 1,177.607 5+ Y[pH4N3] 44.9
85.402 1,090.879 6+ 1,339.961 4+ Y[pH2N2] 29.7
85.402 1,090.879 6+ 1,208.164 4+ Y[pN] 29.7
85.402 1,090.879 6+ 1,380.474 4+ Y[pH3N2] 24.5
85.402 1,090.879 6+ 1,145.197 5+ Y[pH3N3] 20.0
85.402 1,090.879 6+ 1,250.634 5+ Y[pH5N4] 17.9
85.402 1,090.879 6+ 1,299.448 4+ Y[pHN2] 10.6
85.402 1,090.879 6+ 1,431.244 4+ Y[pH3N3] 9.4
85.402 1,090.879 6+ 1,471.757 4+ Y[pH4N3] 9.3
85.402 1,090.879 6+ 1,610.550 3+ Y[pN] 8.8
85.402 1,090.879 6+ 966.733 5+ Y[pN] 7.0
85.402 1,090.879 6+ 1,235.826 5+ Y[pH4N3S] 6.7
85.402 1,090.879 6+ 1,157.395 4+ Y[p] 5.4

Spectra

21565;EThcD;85.364;21549;1091.052;Byonic:q-value=2.05e-16/GPS:MinICScore=31.903
21567;HCD;85.370;21549;1091.052;
21647;EThcD;85.602;21641;1090.883;Byonic:q-value=7.85e-14/GPS:MinICScore=20.399
21649;HCD;85.607;21641;1090.883;