TG002928

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4]QTLSLFFTVLQDVPVR.D (PE000280)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4 (N17)
Mod(s)
Molecular Weight 5,401.596
Charge 5+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
87.700 1,077.725 5+ 1,322.369 3+ Y[pN] 17.8
87.700 1,077.725 5+ 1,498.097 3+ Y[pH2N2] 15.5
87.700 1,077.725 5+ 1,552.115 3+ Y[pH3N2] 12.3
87.700 1,077.725 5+ 1,444.080 3+ Y[pHN2] 7.3

Spectra

22304;EThcD;87.695;22294;1078.130;Byonic:q-value=0.000106/GPS:MinICScore=16.075
22306;HCD;87.700;22294;1078.130;