TG002925

From GPTWiki
Jump to navigation Jump to search
Peptide R.TEVSSNHVLIYLDKVSN[H5N4F]QTLSLFFTVLQDVPVR.D (PE001284)
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4F (N17)
Mod(s)
Molecular Weight 5,547.654
Charge 5+
Protein A2M (P01023)
Spectrum File MS_48_UO1_Erlic_E10
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
87.473 87.130 1,106.937 5+ 1,600.801 3+ Y[pH3N2F]* 8.3
87.473 87.130 1,106.937 5+ 1,546.783 3+ Y[pH2N2F]* 8.0
87.473 87.130 1,106.937 5+ 1,322.369 3+ Y[pN] 6.9
87.473 87.130 1,106.937 5+ 1,498.097 3+ Y[pH2N2] 5.5

Spectra

22233;EThcD;87.468;22225;1106.940;Byonic:q-value=1.03e-14/GPS:MinICScore=13.004
22235;HCD;87.473;22225;1106.940;