TG002893

From GPTWiki
Jump to navigation Jump to search
Peptide R.VVRPDSELGERPPEDN[H3N3F]QSFQYDHEAFLGKEDSK.T (PE001270)
Sequence VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK
Glycans(s) H3N3F (N16)
Mod(s)
Molecular Weight 5,077.247
Charge 5+
Protein RCN1 (Q15293)
Spectrum File MS_47_UO1_HEK_2_1n
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample HEK293 Cells

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
22.731 22.643 24.001 1,012.855 5+ 1,215.047 4+ Y[pH3N2F] 18.3
22.731 22.643 24.001 1,012.855 5+ 1,174.534 4+ Y[pH2N2F] 12.0
22.731 22.643 24.001 1,012.855 5+ 1,006.223 4+ Y[pN] 11.3
22.731 22.643 24.001 1,012.855 5+ 1,138.019 4+ Y[pH2N2] 10.5
22.731 22.643 24.001 1,012.855 5+ 1,042.738 4+ Y[pNF] 8.6

Spectra

4823;EThcD;22.707;4817;1012.861;Byonic:q-value=1.2e-21/GPS:MinICScore=12.839
4825;HCD;22.712;4817;1012.861;
4835;EThcD;22.744;4831;1013.059;Byonic:q-value=1.21e-19/GPS:MinICScore=17.243
4837;HCD;22.749;4831;1013.059;