TG002860

From GPTWiki
Jump to navigation Jump to search
Peptide R.VNQNLVYESGSLN[H5N4S2]FSKLEIQSQVDSQHVGHSVLTAK.G (PE001243)
Sequence VNQNLVYESGSLNFSKLEIQSQVDSQHVGHSVLTAK
Glycans(s) H5N4S2 (N13)
Mod(s)
Molecular Weight 6,177.791
Charge 5+
Protein APOB (P04114)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.909 47.660 90.289 1,232.964 5+ 1,562.765 3+ Y[pH2N2] 48.1
44.909 47.660 90.289 1,232.964 5+ 1,387.037 3+ Y[pN] 46.8
44.909 47.660 90.289 1,232.964 5+ 1,616.783 3+ Y[pH3N2] 43.6
44.909 47.660 90.289 1,232.964 5+ 1,376.896 4+ Y[pH4N3S] 29.4
44.909 47.660 90.289 1,232.964 5+ 1,304.122 4+ Y[pH4N3] 27.8
44.909 47.660 90.289 1,232.964 5+ 1,738.493 3+ Y[pH4N3] 20.4
44.909 47.660 90.289 1,232.964 5+ 1,508.748 3+ Y[pHN2] 17.8
44.909 47.660 90.289 1,232.964 5+ 1,263.609 4+ Y[pH3N3] 16.5
44.909 47.660 90.289 1,232.964 5+ 1,684.476 3+ Y[pH3N3] 15.7
44.909 47.660 90.289 1,232.964 5+ 1,040.530 4+ Y[pN] 15.7
44.909 47.660 90.289 1,232.964 5+ 1,454.730 3+ Y[pN2] 14.6
44.909 47.660 90.289 1,232.964 5+ 1,395.405 4+ Y[pH5N4] 13.9
44.909 47.660 90.289 1,232.964 5+ 1,336.383 4+ Y[pH3N3S] 12.2
44.909 47.660 90.289 1,232.964 5+ 1,468.179 4+ Y[pH5N4S] 11.6
44.909 47.660 90.289 1,232.964 5+ 1,174.745 5+ Y[pH5N4S] 5.4

Spectra

10151;EThcD;44.904;10147;1233.159;Byonic:q-value=8.4e-08/GPS:MinICScore=591.733
10153;HCD;44.909;10147;1233.159;