TG002858

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H6N4FS]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE001246)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N4FS (N4)
Mod(s)
Molecular Weight 5,779.628
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
69.634 69.751 146.289 1,153.331 5+ 1,248.644 3+ Y[pN] 15.7
69.634 69.751 146.289 1,153.331 5+ 1,277.355 4+ Y[pH5N3F] 9.0
69.634 69.751 146.289 1,153.331 5+ 1,095.112 5+ Y[pH6N4F] 8.9
69.634 69.751 146.289 1,153.331 5+ 1,486.734 3+ Y[pHN3F]* 6.6
69.634 69.751 146.289 1,153.331 5+ 1,370.355 3+ Y[pHN2] 6.3

Spectra

17420;EThcD;69.626;17409;1153.326;Byonic:q-value=4.41e-07/GPS:MinICScore=448.356
17422;HCD;69.634;17409;1153.326;