TG002857

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE001247)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,744.562
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
72.258 69.637 146.000 1,432.646 4+ 1,594.084 3+ Y[pH4N3] 33.5
72.258 69.637 146.000 1,432.646 4+ 1,691.116 3+ Y[pH4N3S] 16.2
72.258 69.637 146.000 1,432.646 4+ 1,540.066 3+ Y[pH3N3] 16.0
72.258 69.637 146.000 1,432.646 4+ 1,359.872 4+ Y[pH5N4S] 10.8
72.258 69.637 146.000 1,432.646 4+ 1,418.355 3+ Y[pH2N2] 5.9

Spectra

18210;EThcD;72.251;18198;1433.143;Byonic:q-value=0.000402/GPS:MinICScore=27.535
18212;HCD;72.258;18198;1433.143;