TG002854

From GPTWiki
Jump to navigation Jump to search
Peptide R.VNQNLVYESGSLN[H5N4S]FSKLEIQSQVDSQHVGHSVLTAK.G (PE001244)
Sequence VNQNLVYESGSLNFSKLEIQSQVDSQHVGHSVLTAK
Glycans(s) H5N4S (N13)
Mod(s)
Molecular Weight 5,886.695
Charge 5+
Protein APOB (P04114)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
40.067 40.051 71.000 1,174.745 5+ 1,562.765 3+ Y[pH2N2] 27.2
40.067 40.051 71.000 1,174.745 5+ 1,387.037 3+ Y[pN] 26.8
40.067 40.051 71.000 1,174.745 5+ 1,616.783 3+ Y[pH3N2] 23.9
40.067 40.051 71.000 1,174.745 5+ 1,304.122 4+ Y[pH4N3] 15.0
40.067 40.051 71.000 1,174.745 5+ 1,040.530 4+ Y[pN] 11.9
40.067 40.051 71.000 1,174.745 5+ 1,508.748 3+ Y[pHN2] 11.0
40.067 40.051 71.000 1,174.745 5+ 1,454.730 3+ Y[pN2] 8.9
40.067 40.051 71.000 1,174.745 5+ 1,263.609 4+ Y[pH3N3] 8.7
40.067 40.051 71.000 1,174.745 5+ 1,738.493 3+ Y[pH4N3] 8.6
40.067 40.051 71.000 1,174.745 5+ 1,684.476 3+ Y[pH3N3] 7.1

Spectra

8744;EThcD;40.059;8743;1175.141;Byonic:q-value=1.16e-07/GPS:MinICScore=242.514
8746;HCD;40.067;8743;1175.141;