TG002849

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H7N6FS4]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE001249)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H7N6FS4 (N4)
Mod(s)
Molecular Weight 7,203.075
Charge 5+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
85.454 85.301 185.707 1,438.021 5+ 1,715.795 3+ Y[pH5N4] 17.4
85.454 85.301 185.707 1,438.021 5+ 1,540.066 3+ Y[pH3N3] 15.7
85.454 85.301 185.707 1,438.021 5+ 1,812.826 3+ Y[pH5N4S] 10.4
85.454 85.301 185.707 1,438.021 5+ 1,560.443 4+ Y[pH6N5FS2] 10.1
85.454 85.301 185.707 1,438.021 5+ 1,523.929 4+ Y[pH6N5S2] 8.9
85.454 85.301 185.707 1,438.021 5+ 1,242.627 3+ Y[pN] 7.8
85.454 85.301 185.707 1,438.021 5+ 1,633.217 4+ Y[pH6N5FS3] 6.9
85.454 85.301 185.707 1,438.021 5+ 1,596.702 4+ Y[pH6N5S3] 6.5
85.454 85.301 185.707 1,438.021 5+ 1,661.777 3+ Y[pH4N4] 6.4
85.454 85.301 185.707 1,438.021 5+ 1,764.481 3+ Y[pH5N4F] 6.2
85.454 85.301 185.707 1,438.021 5+ 1,637.098 3+ Y[pH3N3S] 5.6
85.454 85.301 185.707 1,438.021 5+ 1,594.084 3+ Y[pH4N3] 5.1

Spectra

21922;EThcD;85.446;21920;1438.015;Byonic:q-value=0.00582/GPS:MinICScore=29.576
21924;HCD;85.454;21920;1438.015;