TG002845

From GPTWiki
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N3S]GSLFAFR.G (PE001225)
Sequence GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFR
Glycans(s) H5N3S (N62)
Mod(s) 57.021 (C49)
Molecular Weight 9,193.272
Charge 8+
Protein VTN (P04004)
Spectrum File MS_35_Frac_plasma_run01_fr8_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
41.362 41.465 72.032 1,147.917 8+ 1,111.530 8+ Y[pH5N3] 63.6
41.362 41.465 72.032 1,147.917 8+ 1,218.014 7+ Y[pH4N2] 25.1
41.362 41.465 72.032 1,147.917 8+ 1,278.967 6+ Y[pN] 12.7
41.362 41.465 72.032 1,147.917 8+ 1,171.714 7+ Y[pH2N2] 9.3
41.362 41.465 72.032 1,147.917 8+ 1,091.274 8+ Y[pH4N3] 7.3
41.362 41.465 72.032 1,147.917 8+ 1,096.401 7+ Y[pN] 7.0

Spectra

9602;EThcD;41.354;9601;1148.165;Byonic:q-value=8.83e-07/GPS:MinICScore=112.550
9604;HCD;41.362;9601;1148.165;