TG002837

From GPTWiki
Jump to navigation Jump to search
Peptide K.GGETAQSADPQWEQLNNKN[H6N5S3]LSMPLLPADFHK.E (PE001223)
Sequence GGETAQSADPQWEQLNNKNLSMPLLPADFHK
Glycans(s) H6N5S3 (N19)
Mod(s)
Molecular Weight 6,314.662
Charge 4+
Protein SERPIND1 (P05546)
Spectrum File MS_35_Frac_plasma_run01_fr8_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
52.824 52.706 101.351 1,575.171 4+ 1,502.397 4+ Y[pH6N5S2] 82.3
52.824 52.706 101.351 1,575.171 4+ 1,687.086 3+ Y[pH5N4] 37.9
52.824 52.706 101.351 1,575.171 4+ 1,429.623 4+ Y[pH6N5S] 35.7
52.824 52.706 101.351 1,575.171 4+ 1,784.117 3+ Y[pH5N4S] 30.4
52.824 52.706 101.351 1,575.171 4+ 1,511.357 3+ Y[pH3N3] 23.8
52.824 52.706 101.351 1,575.171 4+ 1,633.068 3+ Y[pH4N4] 19.9
52.824 52.706 101.351 1,575.171 4+ 1,565.375 3+ Y[pH4N3] 17.7
52.824 52.706 101.351 1,575.171 4+ 1,881.149 3+ Y[pH5N4S2] 14.5
52.824 52.706 101.351 1,575.171 4+ 1,213.918 3+ Y[pN] 13.4
52.824 52.706 101.351 1,575.171 4+ 1,608.389 3+ Y[pH3N3S] 11.9
52.824 52.706 101.351 1,575.171 4+ 1,905.828 3+ Y[pH6N5S] 8.5
52.824 52.706 101.351 1,575.171 4+ 1,820.373 2+ Y[pN] 8.4
52.824 52.706 101.351 1,575.171 4+ 1,808.796 3+ Y[pH6N5] 8.1

Spectra

12912;EThcD;52.816;12897;1575.662;Byonic:q-value=3.23e-07/GPS:MinICScore=24.198
12914;HCD;52.824;12897;1575.662;