TG002795

From GPTWiki
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5,419.406
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr12_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
85.538 85.364 185.584 1,351.357 4+ 1,278.583 4+ Y[pH5N4S] 21.0
85.538 85.364 185.584 1,351.357 4+ 1,700.859 2+ Y[pN] 15.4
85.538 85.364 185.584 1,351.357 4+ 1,582.730 3+ Y[pH4N3S] 13.6
85.538 85.364 185.584 1,351.357 4+ 1,485.699 3+ Y[pH4N3] 11.5
85.538 85.364 185.584 1,351.357 4+ 1,964.451 2+ Y[pH2N2] 7.9
85.538 85.364 185.584 1,351.357 4+ 1,431.681 3+ Y[pH3N3] 6.9
85.538 85.364 185.584 1,351.357 4+ 1,528.713 3+ Y[pH3N3S] 5.0

Spectra

21672;EThcD;84.967;21671;1351.602;Byonic:q-value=7.15e-08/GPS:MinICScore=12.008
21674;HCD;84.976;21671;1351.602;
21762;EThcD;85.270;21755;1351.351;Byonic:q-value=4.29e-08/GPS:MinICScore=7.348
21764;HCD;85.276;21755;1351.351;
21912;EThcD;85.794;21909;1351.605;Byonic:q-value=5.39e-05/GPS:MinICScore=11.029
21913;HCD;85.799;21909;1351.605;
21916;EThcD;85.810;21914;1351.353;Byonic:q-value=0.000364/GPS:MinICScore=20.395
21918;HCD;85.817;21914;1351.353;