TG002793

From GPTWiki
Jump to navigation Jump to search
Peptide K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L (PE001186)
Sequence SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK
Glycans(s) H9N2 (N14)
Mod(s)
Molecular Weight 5,746.624
Charge 4+
Protein APOB (P04114)
Spectrum File MS_35_Frac_plasma_run01_fr12_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.067 74.532 158.132 1,433.161 4+ 1,356.694 3+ Y[pN] 100.0
74.067 74.532 158.132 1,433.161 4+ 1,230.595 4+ Y[pH4N2] 27.5
74.067 74.532 158.132 1,433.161 4+ 1,190.082 4+ Y[pH3N2] 23.7
74.067 74.532 158.132 1,433.161 4+ 1,271.108 4+ Y[pH5N2] 21.1
74.067 74.532 158.132 1,433.161 4+ 1,149.569 4+ Y[pH2N2] 16.8
74.067 74.532 158.132 1,433.161 4+ 1,424.387 3+ Y[pN2] 12.2
74.067 74.532 158.132 1,433.161 4+ 1,109.056 4+ Y[pHN2] 11.3
74.067 74.532 158.132 1,433.161 4+ 1,478.405 3+ Y[pHN2] 8.9
74.067 74.532 158.132 1,433.161 4+ 1,352.135 4+ Y[pH7N2] 8.5
74.067 74.532 158.132 1,433.161 4+ 1,289.001 3+ Y[p] 7.9
74.067 74.532 158.132 1,433.161 4+ 1,532.422 3+ Y[pH2N2] 7.2
74.067 74.532 158.132 1,433.161 4+ 1,640.458 3+ Y[pH4N2] 6.6
74.067 74.532 158.132 1,433.161 4+ 1,068.542 4+ Y[pN2] 5.7
74.067 74.532 158.132 1,433.161 4+ 1,586.440 3+ Y[pH3N2] 5.6

Spectra

18419;EThcD;74.061;18405;1433.156;Byonic:q-value=2.14e-17/GPS:MinICScore=22.777
18421;HCD;74.067;18405;1433.156;