TG002780

From GPTWiki
Jump to navigation Jump to search
Peptide K.IVLDPSGSMNIYLVLDGSDSIGASN[H5N4S2]FTGAK.K (PE000102)
Sequence IVLDPSGSMNIYLVLDGSDSIGASNFTGAK
Glycans(s) H5N4S2 (N25)
Mod(s)
Molecular Weight 5,263.289
Charge 4+
Protein CFB (P00751)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
79.120 81.273 175.497 1,312.328 4+ 1,622.801 2+ Y[pN] 37.7
79.120 81.273 175.497 1,312.328 4+ 1,886.393 2+ Y[pH2N2] 13.0
79.120 81.273 175.497 1,312.328 4+ 1,967.420 2+ Y[pH3N2] 12.0
79.120 81.273 175.497 1,312.328 4+ 1,805.367 2+ Y[pHN2] 5.6

Spectra

20100;EThcD;78.983;20095;1312.327;Byonic:q-value=6.7e-06/GPS:MinICScore=37.378
20102;HCD;78.991;20095;1312.327;
20135;EThcD;79.113;20124;1312.570;Byonic:q-value=1.49e-05/GPS:MinICScore=72.150
20137;HCD;79.120;20124;1312.570;
20307;EThcD;79.709;20303;1312.572;Byonic:q-value=8.74e-07/GPS:MinICScore=23.197
20309;HCD;79.715;20303;1312.572;