TG002767

From GPTWiki
Jump to navigation Jump to search
Peptide R.FSLLGHASISCTVEN[H5N4S2]ETIGVWRPSPPTCEK.I (PE000134)
Sequence FSLLGHASISCTVENETIGVWRPSPPTCEK
Glycans(s) H5N4S2 (N15)
Mod(s) 57.021 (C11), 57.021 (C28)
Molecular Weight 5,594.411
Charge 4+
Protein C4BPA (P04003)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
49.703 49.663 95.366 1,395.114 4+ 1,544.042 3+ Y[pH4N3] 70.4
49.703 49.663 95.366 1,395.114 4+ 1,490.024 3+ Y[pH3N3] 37.5
49.703 49.663 95.366 1,395.114 4+ 1,192.585 3+ Y[pN] 36.1
49.703 49.663 95.366 1,395.114 4+ 1,322.340 4+ Y[pH5N4S] 20.8
49.703 49.663 95.366 1,395.114 4+ 1,665.753 3+ Y[pH5N4] 14.4
49.703 49.663 95.366 1,395.114 4+ 1,368.314 3+ Y[pH2N2] 10.4
49.703 49.663 95.366 1,395.114 4+ 1,788.374 2+ Y[pN] 9.1
49.703 49.663 95.366 1,395.114 4+ 1,422.331 3+ Y[pH3N2] 8.4
49.703 49.663 95.366 1,395.114 4+ 1,762.784 3+ Y[pH5N4S] 8.0
49.703 49.663 95.366 1,395.114 4+ 1,249.566 4+ Y[pH5N4] 6.9
49.703 49.663 95.366 1,395.114 4+ 1,260.278 3+ Y[pN2] 6.0
49.703 49.663 95.366 1,395.114 4+ 1,314.296 3+ Y[pHN2] 5.2

Spectra

11430;EThcD;49.253;11426;1395.353;Byonic:q-value=1.21e-09/GPS:MinICScore=47.937
11432;HCD;49.259;11426;1395.353;
11748;EThcD;50.372;11742;1395.346;Byonic:q-value=1.84e-08/GPS:MinICScore=62.699
11750;HCD;50.378;11742;1395.346;