TG002742

From GPTWiki
Jump to navigation Jump to search
Peptide K.GGETAQSADPQWEQLNNKN[H5N4S2]LSMPLLPADFHK.E (PE000489)
Sequence GGETAQSADPQWEQLNNKNLSMPLLPADFHK
Glycans(s) H5N4S2 (N19)
Mod(s)
Molecular Weight 5,658.435
Charge 4+
Protein SERPIND1 (P05546)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
47.734 47.671 90.316 1,411.114 4+ 1,565.375 3+ Y[pH4N3] 62.1
47.734 47.671 90.316 1,411.114 4+ 1,338.340 4+ Y[pH5N4S] 45.7
47.734 47.671 90.316 1,411.114 4+ 1,662.407 3+ Y[pH4N3S] 31.2
47.734 47.671 90.316 1,411.114 4+ 1,511.357 3+ Y[pH3N3] 30.5
47.734 47.671 90.316 1,411.114 4+ 1,687.086 3+ Y[pH5N4] 20.6
47.734 47.671 90.316 1,411.114 4+ 1,265.566 4+ Y[pH5N4] 16.0
47.734 47.671 90.316 1,411.114 4+ 1,820.373 2+ Y[pN] 14.2
47.734 47.671 90.316 1,411.114 4+ 1,213.918 3+ Y[pN] 13.9
47.734 47.671 90.316 1,411.114 4+ 1,784.117 3+ Y[pH5N4S] 11.1
47.734 47.671 90.316 1,411.114 4+ 1,389.647 3+ Y[pH2N2] 8.5
47.734 47.671 90.316 1,411.114 4+ 1,443.664 3+ Y[pH3N2] 5.8
47.734 47.671 90.316 1,411.114 4+ 1,281.611 3+ Y[pN2] 5.8
47.734 47.671 90.316 1,411.114 4+ 1,633.068 3+ Y[pH4N4] 5.3

Spectra

10982;EThcD;47.728;10967;1411.612;Byonic:q-value=7.51e-09/GPS:MinICScore=26.049
10984;HCD;47.734;10967;1411.612;