TG002719

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H6N5S3]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000260)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6,418.841
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.259 75.195 160.089 1,281.174 5+ 1,600.101 3+ Y[pH4N3] 22.2
75.259 75.195 160.089 1,281.174 5+ 1,424.373 3+ Y[pH2N2] 18.7
75.259 75.195 160.089 1,281.174 5+ 1,546.083 3+ Y[pH3N3] 17.5
75.259 75.195 160.089 1,281.174 5+ 1,601.215 4+ Y[pH6N5S3] 15.3
75.259 75.195 160.089 1,281.174 5+ 1,248.644 3+ Y[pN] 12.1
75.259 75.195 160.089 1,281.174 5+ 1,364.385 4+ Y[pH5N4S] 10.6
75.259 75.195 160.089 1,281.174 5+ 1,437.158 4+ Y[pH5N4S2] 8.7
75.259 75.195 160.089 1,281.174 5+ 1,370.355 3+ Y[pHN2] 8.3
75.259 75.195 160.089 1,281.174 5+ 1,697.133 3+ Y[pH4N3S] 7.5
75.259 75.195 160.089 1,281.174 5+ 1,721.812 3+ Y[pH5N4] 7.2
75.259 75.195 160.089 1,281.174 5+ 1,872.463 2+ Y[pN] 7.1
75.259 75.195 160.089 1,281.174 5+ 1,455.668 4+ Y[pH6N5S] 5.5
75.259 75.195 160.089 1,281.174 5+ 1,667.794 3+ Y[pH4N4] 5.5

Spectra

19054;EThcD;75.251;19044;1281.169;Byonic:q-value=0.000215/GPS:MinICScore=17.939
19056;HCD;75.259;19044;1281.169;