TG002716

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
70.940 69.713 146.192 1,149.928 5+ 1,478.390 3+ Y[pH3N2] 35.6
70.940 69.713 146.192 1,149.928 5+ 1,424.373 3+ Y[pH2N2] 31.4
70.940 69.713 146.192 1,149.928 5+ 1,248.644 3+ Y[pN] 18.8
70.940 69.713 146.192 1,149.928 5+ 1,600.101 3+ Y[pH4N3] 14.5
70.940 69.713 146.192 1,149.928 5+ 1,370.355 3+ Y[pHN2] 9.3
70.940 69.713 146.192 1,149.928 5+ 1,546.083 3+ Y[pH3N3] 9.2
70.940 69.713 146.192 1,149.928 5+ 1,872.463 2+ Y[pN] 9.9
70.940 69.713 146.192 1,149.928 5+ 1,316.337 3+ Y[pN2] 6.6
70.940 69.713 146.192 1,149.928 5+ 1,273.102 4+ Y[pH4N3S] 6.3
70.940 69.713 146.192 1,149.928 5+ 1,200.328 4+ Y[pH4N3] 6.2

Spectra

17336;EThcD;69.337;17330;1149.925;Byonic:q-value=3.31e-09/GPS:MinICScore=15.062
17338;HCD;69.343;17330;1149.925;
17724;EThcD;70.651;17721;1149.921;Byonic:q-value=1.07e-08/GPS:MinICScore=10.114
17726;HCD;70.656;17721;1149.921;
18030;EThcD;71.643;18028;1150.124;Byonic:q-value=0.00132/GPS:MinICScore=47.496
18032;HCD;71.649;18028;1150.124;
18479;EThcD;73.167;18478;1150.324;Byonic:q-value=0.000133/GPS:MinICScore=84.347
18481;HCD;73.175;18478;1150.324;