TG002704

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLK.R (PE000080)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,390.746
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
87.774 87.613 191.568 1,594.192 4+ 1,785.386 2+ Y[pN] 11.7
87.774 87.613 191.568 1,594.192 4+ 1,760.793 3+ Y[pH5N4S] 11.2
87.774 87.613 191.568 1,594.192 4+ 1,585.064 3+ Y[pH3N3S] 10.4
87.774 87.613 191.568 1,594.192 4+ 1,857.824 3+ Y[pH5N4S2] 10.2
87.774 87.613 191.568 1,594.192 4+ 1,809.479 3+ Y[pH5N4FS] 8.1
87.774 87.613 191.568 1,594.192 4+ 1,906.510 3+ Y[pH5N4FS2] 8.0
87.774 87.613 191.568 1,594.192 4+ 1,488.033 3+ Y[pH3N3] 6.6
87.774 87.613 191.568 1,594.192 4+ 1,663.761 3+ Y[pH5N4] 5.6
87.774 87.613 191.568 1,594.192 4+ 1,190.593 3+ Y[pN] 5.5

Spectra

22556;EThcD;87.761;22546;1594.186;Byonic:q-value=1.22e-07/GPS:MinICScore=23.094
22558;HCD;87.774;22546;1594.186;