TG002694

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLK.R (PE000077)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,588.46
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
80.454 80.312 173.060 1,393.620 4+ 1,639.082 3+ Y[pH4N3S] 24.3
80.454 80.312 173.060 1,393.620 4+ 1,542.050 3+ Y[pH4N3] 22.9
80.454 80.312 173.060 1,393.620 4+ 1,785.386 2+ Y[pN] 21.7
80.454 80.312 173.060 1,393.620 4+ 1,488.033 3+ Y[pH3N3] 13.5
80.454 80.312 173.060 1,393.620 4+ 1,585.064 3+ Y[pH3N3S] 8.5
80.454 80.312 173.060 1,393.620 4+ 1,760.793 3+ Y[pH5N4S] 7.5
80.454 80.312 173.060 1,393.620 4+ 1,663.761 3+ Y[pH5N4] 6.6

Spectra

20520;EThcD;80.448;20511;1393.616;Byonic:q-value=8.78e-08/GPS:MinICScore=41.270
20522;HCD;80.454;20511;1393.616;