TG002688

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4FS2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000254)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4FS2 (N4)
Mod(s)
Molecular Weight 5,908.671
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
69.520 69.740 146.261 1,473.673 4+ 1,473.059 3+ Y[pH2N2F]* 35.4
69.520 69.740 146.261 1,473.673 4+ 1,600.101 3+ Y[pH4N3] 26.5
69.520 69.740 146.261 1,473.673 4+ 1,648.787 3+ Y[pH4N3F] 15.2
69.520 69.740 146.261 1,473.673 4+ 1,546.083 3+ Y[pH3N3] 14.0
69.520 69.740 146.261 1,473.673 4+ 1,248.644 3+ Y[pN] 10.7
69.520 69.740 146.261 1,473.673 4+ 1,697.133 3+ Y[pH4N3S] 8.4
69.520 69.740 146.261 1,473.673 4+ 1,424.373 3+ Y[pH2N2] 8.0
69.520 69.740 146.261 1,473.673 4+ 1,594.769 3+ Y[pH3N3F] 7.5
69.520 69.740 146.261 1,473.673 4+ 1,328.125 4+ Y[pH5N4F] 7.0
69.520 69.740 146.261 1,473.673 4+ 1,745.819 3+ Y[pH4N3FS] 6.7
69.520 69.740 146.261 1,473.673 4+ 1,478.390 3+ Y[pH3N2] 5.9
69.520 69.740 146.261 1,473.673 4+ 1,872.463 2+ Y[pN] 5.9

Spectra

17375;EThcD;69.467;17362;1473.665;Byonic:q-value=4.76e-07/GPS:MinICScore=47.900
17377;HCD;69.475;17362;1473.665;