TG002674

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4FS2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000254)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4FS2 (N4)
Mod(s)
Molecular Weight 5,908.671
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run01_fr9_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
69.520 69.696 146.149 1,179.140 5+ 1,478.390 3+ Y[pH3N2] 30.9
69.520 69.696 146.149 1,179.140 5+ 1,424.373 3+ Y[pH2N2] 25.4
69.520 69.696 146.149 1,179.140 5+ 1,248.644 3+ Y[pN] 16.5
69.520 69.696 146.149 1,179.140 5+ 1,527.076 3+ Y[pH3N2F]* 9.2
69.520 69.696 146.149 1,179.140 5+ 1,370.355 3+ Y[pHN2] 9.1
69.520 69.696 146.149 1,179.140 5+ 1,600.101 3+ Y[pH4N3] 8.7
69.520 69.696 146.149 1,179.140 5+ 1,546.083 3+ Y[pH3N3] 7.2
69.520 69.696 146.149 1,179.140 5+ 1,872.463 2+ Y[pN] 6.9
69.520 69.696 146.149 1,179.140 5+ 1,316.337 3+ Y[pN2] 6.5
69.520 69.696 146.149 1,179.140 5+ 1,473.059 3+ Y[pH2N2F]* 5.4

Spectra

17401;EThcD;69.558;17394;1179.137;Byonic:q-value=6.61e-10/GPS:MinICScore=14.383
17403;HCD;69.566;17394;1179.137;