TG002635

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5FS3]ASALFILPDQDKMEEVEAMLLPETLK.R (PE000080)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H6N5FS3 (N4)
Mod(s)
Molecular Weight 6,390.746
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run01_fr8_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
87.554 87.976 193.345 1,594.192 4+ 1,760.793 3+ Y[pH5N4S] 14.9
87.554 87.976 193.345 1,594.192 4+ 1,585.064 3+ Y[pH3N3S] 12.9
87.554 87.976 193.345 1,594.192 4+ 1,785.386 2+ Y[pN] 12.4
87.554 87.976 193.345 1,594.192 4+ 1,857.824 3+ Y[pH5N4S2] 12.1
87.554 87.976 193.345 1,594.192 4+ 1,809.479 3+ Y[pH5N4FS] 10.6
87.554 87.976 193.345 1,594.192 4+ 1,906.510 3+ Y[pH5N4FS2] 9.9
87.554 87.976 193.345 1,594.192 4+ 1,488.033 3+ Y[pH3N3] 9.0
87.554 87.976 193.345 1,594.192 4+ 1,663.761 3+ Y[pH5N4] 7.8
87.554 87.976 193.345 1,594.192 4+ 1,190.593 3+ Y[pN] 5.6

Spectra

22594;EThcD;87.547;22591;1594.690;Byonic:q-value=8.01e-08/GPS:MinICScore=52.260
22596;HCD;87.554;22591;1594.690;