TG002633

From GPTWiki
Jump to navigation Jump to search
Peptide K.CGLVPVLAENYN[H6N6F]KSDNCEDTPEAGYFAIAVVK.K (PE001166)
Sequence CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVK
Glycans(s) H6N6F (N12)
Mod(s) 57.021 (C1), 57.021 (C17)
Molecular Weight 5,897.531
Charge 5+
Protein TF (P02787)
Spectrum File MS_35_Frac_plasma_run02_fr9
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
56.604 56.653 112.510 1,176.917 5+ 1,419.996 3+ Y[pHN2F]* 22.3
56.604 56.653 112.510 1,176.917 5+ 1,474.014 3+ Y[pH2N2F]* 18.2
56.604 56.653 112.510 1,176.917 5+ 1,365.978 3+ Y[pN2F]* 10.7
56.604 56.653 112.510 1,176.917 5+ 1,420.124 4+ Y[pH6N5F] 8.7
56.604 56.653 112.510 1,176.917 5+ 1,595.724 3+ Y[pH3N3F] 8.4
56.604 56.653 112.510 1,176.917 5+ 1,541.707 3+ Y[pH2N3F] 7.5
56.604 56.653 112.510 1,176.917 5+ 1,312.840 4+ Y[pH3N6] 6.2

Spectra

13571;EThcD;56.599;13560;1177.102;Byonic:q-value=7.89e-05/GPS:MinICScore=21.306
13573;HCD;56.604;13560;1177.102;