TG002423

From GPTWiki
Jump to navigation Jump to search
Peptide K.SLGNVN[H6N3]FTVSAEALESQELCGTEVPSVPEHGRK.D (PE001070)
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H6N3 (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5,140.281
Charge 4+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MS2_new_measurement_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum