TG002392

From GPTWiki
Jump to navigation Jump to search
Peptide R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H8N7F]LTHLPANLLQGASK.L (PE001038)
Sequence SDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASK
Glycans(s) H8N7F (N32)
Mod(s) 57.021 (C9)
Molecular Weight 7,780.48
Charge 6+
Protein LRG1 (P02750)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
83.392 83.671 1,294.755 6+ 1,539.982 4+ Y[pH4N3] 17.1
83.392 83.671 1,294.755 6+ 1,499.469 4+ Y[pH3N3] 11.0
83.392 83.671 1,294.755 6+ 1,701.516 3+ Y[pN] 7.2
83.392 83.671 1,294.755 6+ 1,631.265 4+ Y[pH5N4] 6.3
83.392 83.671 1,294.755 6+ 1,408.186 4+ Y[pH2N2] 5.8
83.392 83.671 1,294.755 6+ 1,590.752 4+ Y[pH4N4] 5.0

Spectra

25580;EThcD;83.387;25566;1294.751;Byonic:q-value=4.27e-09/GPS:MinICScore=198.861
25582;HCD;83.392;25566;1294.751;