TG002264

From GPTWiki
Jump to navigation Jump to search
Peptide K.TKPREEQYN[H4N3F]STYRVVSVLTVLHQDWLNGKEYK.C (PE000968)
Sequence TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
Glycans(s) H4N3F (N9)
Mod(s)
Molecular Weight 5,301.509
Charge 5+
Protein IGHG1 (P01857)
Spectrum File IgG_Glycopeptide_HCD_V1.E24
Method QExactive, DDA (HCD), Multi-CE
Analytical Fraction
Sample NIST IgG Standard

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
69.376 1,057.707 5+ 1,230.599 4+ Y[pH3N2F]* 100.0
69.376 1,057.707 5+ 1,190.086 4+ Y[pH2N2F]* 52.5
69.376 1,057.707 5+ 1,194.085 4+ Y[pH3N2] 12.8
69.376 1,057.707 5+ 1,058.290 4+ Y[pNF]* 8.9
69.376 1,057.707 5+ 1,153.572 4+ Y[pH2N2] 8.9
69.376 1,057.707 5+ 1,149.573 4+ Y[pHN2F]* 7.2
69.376 1,057.707 5+ 1,281.369 4+ Y[pH3N3F] 5.5

Spectra

46;HCD;69.296;;1057.703;GPS:MinICScore=553.714