TG002015

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S2]YSCSYR.T (PE000856)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S2 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,423.585
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
45.997 45.982 85.341 1,602.405 4+ 1,529.631 4+ Y[pH6N5S] 47.1
45.997 45.982 85.341 1,602.405 4+ 1,820.429 3+ Y[pH5N4] 31.9
45.997 45.982 85.341 1,602.405 4+ 1,644.701 3+ Y[pH3N3] 23.8
45.997 45.982 85.341 1,602.405 4+ 1,347.262 3+ Y[pN] 20.9
45.997 45.982 85.341 1,602.405 4+ 1,917.461 3+ Y[pH5N4S] 20.8
45.997 45.982 85.341 1,602.405 4+ 1,347.065 4+ Y[pH4N3S] 17.9
45.997 45.982 85.341 1,602.405 4+ 1,456.857 4+ Y[pH6N5] 8.4
45.997 45.982 85.341 1,602.405 4+ 1,766.411 3+ Y[pH4N4] 7.7
45.997 45.982 85.341 1,602.405 4+ 1,741.733 3+ Y[pH3N3S] 7.1
45.997 45.982 85.341 1,602.405 4+ 1,698.718 3+ Y[pH4N3] 5.9

Spectra

11015;EThcD;45.988;11013;1602.647;Byonic:q-value=1.31e-06/GPS:MinICScore=14.028
11017;HCD;45.997;11013;1602.647;