TG001904

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run01_fr6_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
42.156 42.095 75.182 1,550.147 4+ 1,477.373 4+ Y[pH5N4S] 100.0
42.156 42.095 75.182 1,550.147 4+ 1,750.752 3+ Y[pH4N3] 62.8
42.156 42.095 75.182 1,550.147 4+ 1,399.295 3+ Y[pN] 19.3
42.156 42.095 75.182 1,550.147 4+ 1,847.784 3+ Y[pH4N3S] 13.1
42.156 42.095 75.182 1,550.147 4+ 1,872.463 3+ Y[pH5N4] 7.6
42.156 42.095 75.182 1,550.147 4+ 1,575.024 3+ Y[pH2N2] 6.2
42.156 42.095 75.182 1,550.147 4+ 1,793.766 3+ Y[pH3N3S] 5.7
42.156 42.095 75.182 1,550.147 4+ 1,629.041 3+ Y[pH3N2] 5.3

Spectra

10446;EThcD;42.150;10441;1550.645;Byonic:q-value=1.05e-06/GPS:MinICScore=16.460
10448;HCD;42.156;10441;1550.645;
10459;EThcD;42.199;10455;1550.389;Byonic:q-value=7.63e-08/GPS:MinICScore=15.826
10461;HCD;42.207;10455;1550.389;