TG001893

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S3]YSCSYR.T (PE000585)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S3 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,714.68
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run01_fr6_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
50.502 50.720 96.884 1,340.344 5+ 1,698.718 3+ Y[pH4N3] 29.8
50.502 50.720 96.884 1,340.344 5+ 1,522.990 3+ Y[pH2N2] 26.0
50.502 50.720 96.884 1,340.344 5+ 1,347.262 3+ Y[pN] 25.9
50.502 50.720 96.884 1,340.344 5+ 1,347.065 4+ Y[pH4N3S] 24.1
50.502 50.720 96.884 1,340.344 5+ 1,644.701 3+ Y[pH3N3] 21.6
50.502 50.720 96.884 1,340.344 5+ 1,795.750 3+ Y[pH4N3S] 12.9
50.502 50.720 96.884 1,340.344 5+ 1,820.429 3+ Y[pH5N4] 12.0
50.502 50.720 96.884 1,340.344 5+ 1,468.972 3+ Y[pHN2] 10.7
50.502 50.720 96.884 1,340.344 5+ 1,414.955 3+ Y[pN2] 7.9
50.502 50.720 96.884 1,340.344 5+ 1,766.411 3+ Y[pH4N4] 6.2
50.502 50.720 96.884 1,340.344 5+ 1,741.733 3+ Y[pH3N3S] 6.0
50.502 50.720 96.884 1,340.344 5+ 1,917.461 3+ Y[pH5N4S] 5.9
50.502 50.720 96.884 1,340.344 5+ 1,438.348 4+ Y[pH5N4S] 5.7

Spectra

12640;EThcD;50.470;12639;1340.739;Byonic:q-value=0.000423/GPS:MinICScore=89.010
12642;HCD;50.479;12639;1340.739;
12653;EThcD;50.516;12652;1340.539;Byonic:q-value=0.000613/GPS:MinICScore=358.067
12655;HCD;50.525;12652;1340.539;