TG001773

From GPTWiki
Jump to navigation Jump to search
Peptide K.SLGNVN[H6N3S]FTVSAEALESQELCGTEVPSVPEHGRK.D (PE000782)
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H6N3S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5,431.377
Charge 4+
Protein A2M (P01023)
Spectrum File MS_31_UO1_MARS_MS2_1ug_longn_CE20_std
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction MARS Depleted
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
39.030 39.065 1,354.352 4+ 1,872.912 2+ Y[pN] 34.3
39.030 39.065 1,354.352 4+ 1,586.725 3+ Y[pH5N2] 24.4
39.030 39.065 1,354.352 4+ 1,532.707 3+ Y[pH4N2] 20.8
39.030 39.065 1,354.352 4+ 1,248.944 3+ Y[pN] 13.8
39.030 39.065 1,354.352 4+ 1,478.690 3+ Y[pH3N2] 10.9
39.030 39.065 1,354.352 4+ 1,424.672 3+ Y[pH2N2] 7.5
39.030 39.065 1,354.352 4+ 1,190.296 4+ Y[pH5N2] 6.8
39.030 39.065 1,354.352 4+ 1,708.436 3+ Y[pH6N3] 6.7
39.030 39.065 1,354.352 4+ 1,771.372 2+ Y[p] 5.3
39.030 39.065 1,354.352 4+ 1,316.637 3+ Y[pN2] 5.1

Spectra

10201;EThcD;39.025;10191;1354.853;Byonic:q-value=3.21e-07/GPS:MinICScore=175.741
10203;HCD;39.030;10191;1354.853;