TG001755

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run01_fr6_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
42.156 42.043 75.051 1,240.319 5+ 1,575.024 3+ Y[pH2N2] 51.3
42.156 42.043 75.051 1,240.319 5+ 1,629.041 3+ Y[pH3N2] 48.9
42.156 42.043 75.051 1,240.319 5+ 1,399.295 3+ Y[pN] 29.9
42.156 42.043 75.051 1,240.319 5+ 1,386.090 4+ Y[pH4N3S] 21.3
42.156 42.043 75.051 1,240.319 5+ 1,313.316 4+ Y[pH4N3] 20.2
42.156 42.043 75.051 1,240.319 5+ 1,750.752 3+ Y[pH4N3] 16.7
42.156 42.043 75.051 1,240.319 5+ 1,521.006 3+ Y[pHN2] 14.7
42.156 42.043 75.051 1,240.319 5+ 1,696.734 3+ Y[pH3N3] 12.8
42.156 42.043 75.051 1,240.319 5+ 1,049.724 4+ Y[pN] 12.4
42.156 42.043 75.051 1,240.319 5+ 1,466.989 3+ Y[pN2] 8.1
42.156 42.043 75.051 1,240.319 5+ 1,345.577 4+ Y[pH3N3S] 6.9
42.156 42.043 75.051 1,240.319 5+ 1,477.373 4+ Y[pH5N4S] 5.9
42.156 42.043 75.051 1,240.319 5+ 1,404.599 4+ Y[pH5N4] 5.6

Spectra

10404;EThcD;42.010;10402;1240.514;Byonic:q-value=2.71e-16/GPS:MinICScore=81.470
10406;HCD;42.016;10402;1240.514;