TG001372

From GPTWiki
Jump to navigation Jump to search
Peptide R.YTCEEPYYYMENGGGGEYHCAGN[H5N4S2]GSWVNEVLGPELPK.C (PE000661)
Sequence YTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
Glycans(s) H5N4S2 (N23)
Mod(s) 57.021 (C3), 57.021 (C20)
Molecular Weight 6,448.56
Charge 4+
Protein C1S (P09871)
Spectrum File MS_35_Frac_plasma_run02_fr8
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
58.318 58.406 115.996 1,608.651 4+ 1,925.790 3+ Y[pH4N3S] 25.9
58.318 58.406 115.996 1,608.651 4+ 1,477.302 3+ Y[pN] 24.5
58.318 58.406 115.996 1,608.651 4+ 1,828.758 3+ Y[pH4N3] 22.0
58.318 58.406 115.996 1,608.651 4+ 1,774.741 3+ Y[pH3N3] 13.7
58.318 58.406 115.996 1,608.651 4+ 1,871.772 3+ Y[pH3N3S] 11.8

Spectra

14045;EThcD;58.174;14039;1609.140;Byonic:q-value=5.22e-06/GPS:MinICScore=87.712
14047;HCD;58.180;14039;1609.140;
14128;EThcD;58.448;14119;1608.641;Byonic:q-value=2.31e-09/GPS:MinICScore=45.741
14130;HCD;58.456;14119;1608.641;