TG001358

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
42.067 42.195 74.809 1,550.147 4+ 1,477.373 4+ Y[pH5N4S] 86.1
42.067 42.195 74.809 1,550.147 4+ 1,750.752 3+ Y[pH4N3] 52.1
42.067 42.195 74.809 1,550.147 4+ 1,399.295 3+ Y[pN] 18.6
42.067 42.195 74.809 1,550.147 4+ 1,847.784 3+ Y[pH4N3S] 10.6
42.067 42.195 74.809 1,550.147 4+ 1,872.463 3+ Y[pH5N4] 6.9
42.067 42.195 74.809 1,550.147 4+ 1,575.024 3+ Y[pH2N2] 5.8

Spectra

9982;EThcD;42.061;9979;1550.387;Byonic:q-value=9.02e-14/GPS:MinICScore=13.048
9984;HCD;42.067;9979;1550.387;