TG001349

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S]YSCSYR.T (PE000538)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S (N28)
Mod(s) 57.021 (C31)
Molecular Weight 5,923.458
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
38.917 38.856 66.553 1,182.100 5+ 1,575.024 3+ Y[pH2N2] 53.3
38.917 38.856 66.553 1,182.100 5+ 1,629.041 3+ Y[pH3N2] 47.6
38.917 38.856 66.553 1,182.100 5+ 1,399.295 3+ Y[pN] 29.6
38.917 38.856 66.553 1,182.100 5+ 1,313.316 4+ Y[pH4N3] 18.2
38.917 38.856 66.553 1,182.100 5+ 1,521.006 3+ Y[pHN2] 16.9
38.917 38.856 66.553 1,182.100 5+ 1,750.752 3+ Y[pH4N3] 11.8
38.917 38.856 66.553 1,182.100 5+ 1,181.520 4+ Y[pH2N2] 10.7
38.917 38.856 66.553 1,182.100 5+ 1,049.724 4+ Y[pN] 10.4
38.917 38.856 66.553 1,182.100 5+ 1,696.734 3+ Y[pH3N3] 9.6
38.917 38.856 66.553 1,182.100 5+ 1,272.803 4+ Y[pH3N3] 12.7
38.917 38.856 66.553 1,182.100 5+ 1,404.599 4+ Y[pH5N4] 5.1

Spectra

9065;EThcD;38.828;9064;1182.291;Byonic:q-value=6.54e-15/GPS:MinICScore=160.091
9067;HCD;38.842;9064;1182.291;
9112;EThcD;38.984;9111;1182.093;Byonic:q-value=2.94e-09/GPS:MinICScore=107.315
9114;HCD;38.992;9111;1182.093;