TG001346

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S3]YSCSYR.T (PE000585)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S3 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,714.68
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
50.926 50.854 96.218 1,675.178 4+ 1,602.405 4+ Y[pH6N5S2] 69.4
50.926 50.854 96.218 1,675.178 4+ 1,820.429 3+ Y[pH5N4] 29.0
50.926 50.854 96.218 1,675.178 4+ 1,529.631 4+ Y[pH6N5S] 23.7
50.926 50.854 96.218 1,675.178 4+ 1,347.262 3+ Y[pN] 23.5
50.926 50.854 96.218 1,675.178 4+ 1,644.701 3+ Y[pH3N3] 21.1
50.926 50.854 96.218 1,675.178 4+ 1,917.461 3+ Y[pH5N4S] 20.8
50.926 50.854 96.218 1,675.178 4+ 1,347.065 4+ Y[pH4N3S] 17.2
50.926 50.854 96.218 1,675.178 4+ 1,741.733 3+ Y[pH3N3S] 11.6
50.926 50.854 96.218 1,675.178 4+ 1,766.411 3+ Y[pH4N4] 8.8
50.926 50.854 96.218 1,675.178 4+ 1,414.955 3+ Y[pN2] 5.7

Spectra

12547;EThcD;50.988;12539;1675.674;Byonic:q-value=0.000157/GPS:MinICScore=20.381
12549;HCD;50.996;12539;1675.674;