TG001335

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000224)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,058.453
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
46.949 46.431 85.282 1,209.099 5+ 1,577.008 3+ Y[pH3N2] 36.3
46.949 46.431 85.282 1,209.099 5+ 1,522.990 3+ Y[pH2N2] 36.2
46.949 46.431 85.282 1,209.099 5+ 1,347.262 3+ Y[pN] 26.9
46.949 46.431 85.282 1,209.099 5+ 1,347.065 4+ Y[pH4N3S] 23.1
46.949 46.431 85.282 1,209.099 5+ 1,698.718 3+ Y[pH4N3] 17.7
46.949 46.431 85.282 1,209.099 5+ 1,644.701 3+ Y[pH3N3] 16.1
46.949 46.431 85.282 1,209.099 5+ 1,468.972 3+ Y[pHN2] 12.3
46.949 46.431 85.282 1,209.099 5+ 1,414.955 3+ Y[pN2] 8.1

Spectra

11307;EThcD;46.816;11305;1209.289;Byonic:q-value=2.85e-14/GPS:MinICScore=16.467
11309;HCD;46.824;11305;1209.289;