TG001314

From GPTWiki
Jump to navigation Jump to search
Peptide R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S3]YSCSYR.T (PE000585)
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S3 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 6,714.68
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr7
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
50.926 50.889 96.305 1,340.344 5+ 1,347.262 3+ Y[pN] 27.8
50.926 50.889 96.305 1,340.344 5+ 1,698.718 3+ Y[pH4N3] 26.8
50.926 50.889 96.305 1,340.344 5+ 1,347.065 4+ Y[pH4N3S] 26.0
50.926 50.889 96.305 1,340.344 5+ 1,522.990 3+ Y[pH2N2] 24.6
50.926 50.889 96.305 1,340.344 5+ 1,644.701 3+ Y[pH3N3] 20.4
50.926 50.889 96.305 1,340.344 5+ 1,468.972 3+ Y[pHN2] 11.4
50.926 50.889 96.305 1,340.344 5+ 1,795.750 3+ Y[pH4N3S] 9.6
50.926 50.889 96.305 1,340.344 5+ 1,820.429 3+ Y[pH5N4] 9.3
50.926 50.889 96.305 1,340.344 5+ 1,414.955 3+ Y[pN2] 7.0
50.926 50.889 96.305 1,340.344 5+ 1,766.411 3+ Y[pH4N4] 6.1

Spectra

12509;EThcD;50.849;12508;1340.741;Byonic:q-value=1.1e-10/GPS:MinICScore=162.041
12511;HCD;50.857;12508;1340.741;