TG001125

From GPTWiki
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G (PE000225)
Sequence GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFR
Glycans(s) H5N4S (N62)
Mod(s) 57.021 (C49)
Molecular Weight 9,396.351
Charge 8+
Protein VTN (P04004)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
41.673 41.826 74.542 1,173.302 8+ 1,223.875 7+ Y[pH3N3] 15.6
41.673 41.826 74.542 1,173.302 8+ 1,366.831 6+ Y[pH2N2] 12.9
41.673 41.826 74.542 1,173.302 8+ 1,171.714 7+ Y[pH2N2] 8.8
41.673 41.826 74.542 1,173.302 8+ 1,278.967 6+ Y[pN] 8.4
41.673 41.826 74.542 1,173.302 8+ 1,393.840 6+ Y[pH3N2] 8.0
41.673 41.826 74.542 1,173.302 8+ 1,116.658 8+ Y[pH4N4] 7.1
41.673 41.826 74.542 1,173.302 8+ 1,153.045 8+ Y[pH4N4S] 6.2
41.673 41.826 74.542 1,173.302 8+ 1,096.401 7+ Y[pN] 6.1
41.673 41.826 74.542 1,173.302 8+ 1,096.402 8+ Y[pH3N4] 5.9

Spectra

9857;EThcD;41.610;9856;1173.545;Byonic:q-value=6.2e-13/GPS:MinICScore=60.490
9859;HCD;41.618;9856;1173.545;