TG001065

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000220)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S (N4)
Mod(s)
Molecular Weight 5,471.518
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
64.762 65.048 134.880 1,364.385 4+ 1,600.101 3+ Y[pH4N3] 50.2
64.762 65.048 134.880 1,364.385 4+ 1,546.083 3+ Y[pH3N3] 22.9
64.762 65.048 134.880 1,364.385 4+ 1,424.373 3+ Y[pH2N2] 8.3
64.762 65.048 134.880 1,364.385 4+ 1,291.611 4+ Y[pH5N4] 8.2
64.762 65.048 134.880 1,364.385 4+ 1,478.390 3+ Y[pH3N2] 7.1
64.762 65.048 134.880 1,364.385 4+ 1,248.644 3+ Y[pN] 6.5
64.762 65.048 134.880 1,364.385 4+ 1,697.133 3+ Y[pH4N3S] 5.7
64.762 65.048 134.880 1,364.385 4+ 1,872.463 2+ Y[pN] 5.2

Spectra

15967;EThcD;64.781;15964;1364.386;Byonic:q-value=8.91e-10/GPS:MinICScore=30.625
15969;HCD;64.789;15964;1364.386;