TG001053

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4]YSCSYR.T (PE000537)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 5,632.363
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
34.978 36.018 59.451 1,123.881 5+ 1,575.024 3+ Y[pH2N2] 35.0
34.978 36.018 59.451 1,123.881 5+ 1,629.041 3+ Y[pH3N2] 29.9
34.978 36.018 59.451 1,123.881 5+ 1,399.295 3+ Y[pN] 20.0
34.978 36.018 59.451 1,123.881 5+ 1,521.006 3+ Y[pHN2] 14.6
34.978 36.018 59.451 1,123.881 5+ 1,313.316 4+ Y[pH4N3] 13.7
34.978 36.018 59.451 1,123.881 5+ 1,272.803 4+ Y[pH3N3] 9.6
34.978 36.018 59.451 1,123.881 5+ 1,049.724 4+ Y[pN] 7.1

Spectra

8008;EThcD;34.973;8003;1124.076;Byonic:q-value=1.02e-09/GPS:MinICScore=58.487
8010;HCD;34.978;8003;1124.076;