TG001042

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S]YSCSYR.T (PE000538)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S (N28)
Mod(s) 57.021 (C31)
Molecular Weight 5,923.458
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_35_Frac_plasma_run02_fr17
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
38.390 40.315 70.616 1,182.100 5+ 1,575.024 3+ Y[pH2N2] 31.3
38.390 40.315 70.616 1,182.100 5+ 1,629.041 3+ Y[pH3N2] 28.5
38.390 40.315 70.616 1,182.100 5+ 1,399.295 3+ Y[pN] 18.7
38.390 40.315 70.616 1,182.100 5+ 1,313.316 4+ Y[pH4N3] 15.5
38.390 40.315 70.616 1,182.100 5+ 1,521.006 3+ Y[pHN2] 11.3
38.390 40.315 70.616 1,182.100 5+ 1,272.803 4+ Y[pH3N3] 9.4
38.390 40.315 70.616 1,182.100 5+ 1,049.724 4+ Y[pN] 7.7
38.390 40.315 70.616 1,182.100 5+ 1,750.752 3+ Y[pH4N3] 6.0

Spectra

8958;EThcD;38.383;8956;1182.091;Byonic:q-value=5.89e-23/GPS:MinICScore=21.453
8960;HCD;38.390;8956;1182.091;